General Information

  • ID:  hor002151
  • Uniprot ID:  P17085
  • Protein name:  Insulin-like growth factor I
  • Gene name:  igf1
  • Organism:  Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  All the isoforms are expressed in embryos, juvenile and adult liver, muscle and brain. At least one isoform is expressed in heart, kidney, testes, ovary, adipose tissue and spleen of juvenile salmon.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction; GO:0043066 negative regulation of apoptotic process; GO:0090201 negative regulation of release of cytochrome c from mitochondria
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA
  • Length:  70
  • Propeptide:  MSSGHLFQWHLCDVFKSAMCCISCTHTLSLLLCVLTLTSAATGAGPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAARSVRAQRHTDMPRTPKVSTAVQNVDRGTERRTAQHPDKTKPKKKPLSGNSHTSCKEVHQKNSSRGNTGGRNYRM
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. Binds to integrins.
  • Mechanism:  Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiatiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-48; 18-61; 47-52
  • Structure ID:  AF-P17085-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002151_AF2.pdbhor002151_ESM.pdb

Physical Information

Mass: 894167 Formula: C332H518N96O102S7
Absent amino acids: W Common amino acids: G
pI: 7.75 Basic residues: 10
Polar residues: 27 Hydrophobic residues: 18
Hydrophobicity: -36 Boman Index: -13299
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 6378.29 Extinction Coefficient cystines: 4845
Absorbance 280nm: 70.22

Literature

  • PubMed ID:  8243465
  • Title:  Recombinant coho salmon insulin-like growth factor I. Expression in Escherichia coli, purification and characterization.